Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) |
Species Human (Homo sapiens), type III [TaxId:9606] [69383] (5 PDB entries) bile acid binding protein |
Domain d2hdja_: 2hdj A: [136343] automated match to d1j96a_ complexed with edo, ndp, so4 |
PDB Entry: 2hdj (more details), 2 Å
SCOPe Domain Sequences for d2hdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hdja_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]} dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr nvryltldifagppnypfsdey
Timeline for d2hdja_: