Lineage for d2hcib1 (2hci B:5-65)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1890897Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 1890927Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (3 PDB entries)
  8. 1890931Domain d2hcib1: 2hci B:5-65 [136337]
    automatically matched to d1m8aa_
    complexed with peg, so3, so4

Details for d2hcib1

PDB Entry: 2hci (more details), 1.81 Å

PDB Description: Structure of Human Mip-3a Chemokine
PDB Compounds: (B:) Small inducible cytokine A20

SCOPe Domain Sequences for d2hcib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcib1 d.9.1.1 (B:5-65) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a [TaxId: 9606]}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k

SCOPe Domain Coordinates for d2hcib1:

Click to download the PDB-style file with coordinates for d2hcib1.
(The format of our PDB-style files is described here.)

Timeline for d2hcib1: