![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
![]() | Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
![]() | Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (3 PDB entries) |
![]() | Domain d2hcib1: 2hci B:5-65 [136337] automatically matched to d1m8aa_ complexed with peg, so3, so4 |
PDB Entry: 2hci (more details), 1.81 Å
SCOPe Domain Sequences for d2hcib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hcib1 d.9.1.1 (B:5-65) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a [TaxId: 9606]} dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls k
Timeline for d2hcib1: