| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
| Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
| Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (2 PDB entries) |
| Domain d2hcia1: 2hci A:5-65 [136336] automatically matched to d1m8aa_ complexed with peg, so3, so4 |
PDB Entry: 2hci (more details), 1.81 Å
SCOP Domain Sequences for d2hcia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hcia1 d.9.1.1 (A:5-65) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a [TaxId: 9606]}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k
Timeline for d2hcia1: