Lineage for d2hchb2 (2hch B:69-337)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579821Species Dog (Canis familiaris) [TaxId:9615] [103225] (35 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2579853Domain d2hchb2: 2hch B:69-337 [136335]
    Other proteins in same PDB: d2hcha3, d2hchb3
    automated match to d1u2oa_
    complexed with 1pe, n5a, pg4

Details for d2hchb2

PDB Entry: 2hch (more details), 2.3 Å

PDB Description: n-domain of grp94 in complex with the novel ligand n-(2-amino)ethyl carboxyamido adenosine
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d2hchb2:

Sequence, based on SEQRES records: (download)

>d2hchb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d2hchb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkstseligqfgvgfy
saflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyle
ldtiknlvkkysqfinfpiyvwssktvwdwelmn

SCOPe Domain Coordinates for d2hchb2:

Click to download the PDB-style file with coordinates for d2hchb2.
(The format of our PDB-style files is described here.)

Timeline for d2hchb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hchb3