Lineage for d2hcfa1 (2hcf A:2-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919696Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919771Protein Hypothetical protein CT1708 [142147] (1 species)
  7. 2919772Species Chlorobium tepidum [TaxId:1097] [142148] (1 PDB entry)
    Uniprot Q8KBS5 2-229
  8. 2919773Domain d2hcfa1: 2hcf A:2-229 [136333]
    complexed with cl, mg

Details for d2hcfa1

PDB Entry: 2hcf (more details), 1.8 Å

PDB Description: crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d2hcfa1:

Sequence, based on SEQRES records: (download)

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}
srtlvlfdidgtllkvesmnrrvladalievygtegstgshdfsgkmdgaiiyevlsnvg
leraeiadkfdkaketyialfrerarreditllegvrelldalssrsdvllglltgnfea
sgrhklklpgidhyfpfgafaddaldrnelphialerarrmtganyspsqiviigdtehd
ircareldarsiavatgnftmeelarhkpgtlfknfaetdevlasilt

Sequence, based on observed residues (ATOM records): (download)

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}
srtlvlfdidgtllkvesmnrrvladalievygtegstdfsgkmdgaiiyevlsnvgler
aeiadkfdkaketyialfrerarreditllegvrelldalssrsdvllglltgnfeasgr
hklklpgidhyfpfgafaddaldrnelphialerarrmtganyspsqiviigdtehdirc
areldarsiavatgnftmeelarhkpgtlfknfaetdevlasilt

SCOPe Domain Coordinates for d2hcfa1:

Click to download the PDB-style file with coordinates for d2hcfa1.
(The format of our PDB-style files is described here.)

Timeline for d2hcfa1: