Lineage for d2hcbd2 (2hcb D:77-289)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697709Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
    contains TrpR-like DNA-binding domain after the family specific domains
  7. 697710Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries)
  8. 697715Domain d2hcbd2: 2hcb D:77-289 [136332]
    Other proteins in same PDB: d2hcba1, d2hcbb1, d2hcbc1, d2hcbd1
    automatically matched to d1l8qa2
    complexed with abg, mg

Details for d2hcbd2

PDB Entry: 2hcb (more details), 3.51 Å

PDB Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus
PDB Compounds: (D:) Chromosomal replication initiator protein dnaA

SCOP Domain Sequences for d2hcbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcbd2 c.37.1.20 (D:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk

SCOP Domain Coordinates for d2hcbd2:

Click to download the PDB-style file with coordinates for d2hcbd2.
(The format of our PDB-style files is described here.)

Timeline for d2hcbd2: