SCOP 1.73: Domain d2hcbc2: 2hcb C:77-289

Lineage for d2hcbc2 (2hcb C:77-289)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
   contains TrpR-like DNA-binding domain after the family specific domains

7. Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries)

8. Domain d2hcbc2: 2hcb C:77-289 [136330]
   Other proteins in same PDB: d2hcba1, d2hcbb1, d2hcbc1, d2hcbd1
   automatically matched to d1l8qa2
   complexed with abg, mg

Details for d2hcbc2

PDB Entry: 2hcb, 3.51 Å

PDB Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus

PDB Compounds: (C:) Chromosomal replication initiator protein dnaA

SCOP Domain Sequences for d2hcbc2:

Sequence; same for both SEQRES and ATOM records:

>d2hcbc2 c.37.1.20 (C:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk

Timeline for d2hcbc2:

• d2hcbc2 is new in SCOP 1.73
  
• d2hcbc2 appears in SCOP 1.75
  
• d2hcbc2 appears in the current release, SCOPe 2.08