Lineage for d2hcbc1 (2hcb C:290-399)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636178Superfamily a.4.12: TrpR-like [48295] (2 families) (S)
    contains an extra shared helix after the HTH motif
  5. 636213Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein)
    monomeric; contains additional N-terminal helices
  6. 636214Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species)
  7. 636215Species Aquifex aeolicus [TaxId:63363] [81697] (2 PDB entries)
  8. 636219Domain d2hcbc1: 2hcb C:290-399 [136329]
    Other proteins in same PDB: d2hcba2, d2hcbb2, d2hcbc2, d2hcbd2
    automatically matched to d1l8qa1
    complexed with abg, mg

Details for d2hcbc1

PDB Entry: 2hcb (more details), 3.51 Å

PDB Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus
PDB Compounds: (C:) Chromosomal replication initiator protein dnaA

SCOP Domain Sequences for d2hcbc1:

Sequence, based on SEQRES records: (download)

>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkkdrkfkhlvgflekqafdkic

Sequence, based on observed residues (ATOM records): (download)

>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdknkrtsearkiamylcrkvcsas
lieiarafdhttvihairsveeekkrkfkhlvgflekqafdkic

SCOP Domain Coordinates for d2hcbc1:

Click to download the PDB-style file with coordinates for d2hcbc1.
(The format of our PDB-style files is described here.)

Timeline for d2hcbc1: