| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (2 families) ![]() contains an extra shared helix after the HTH motif |
| Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein) monomeric; contains additional N-terminal helices |
| Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species) |
| Species Aquifex aeolicus [TaxId:63363] [81697] (2 PDB entries) |
| Domain d2hcbc1: 2hcb C:290-399 [136329] Other proteins in same PDB: d2hcba2, d2hcbb2, d2hcbc2, d2hcbd2 automatically matched to d1l8qa1 complexed with abg, mg |
PDB Entry: 2hcb (more details), 3.51 Å
SCOP Domain Sequences for d2hcbc1:
Sequence, based on SEQRES records: (download)
>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkkdrkfkhlvgflekqafdkic
>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdknkrtsearkiamylcrkvcsas
lieiarafdhttvihairsveeekkrkfkhlvgflekqafdkic
Timeline for d2hcbc1: