Lineage for d2hcbc1 (2hcb C:290-399)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695814Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein)
    monomeric; contains additional N-terminal helices
  6. 2695815Protein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species)
  7. 2695816Species Aquifex aeolicus [TaxId:63363] [81697] (2 PDB entries)
  8. 2695820Domain d2hcbc1: 2hcb C:290-399 [136329]
    Other proteins in same PDB: d2hcba2, d2hcbb2, d2hcbc2, d2hcbd2
    automatically matched to d1l8qa1
    complexed with acp, mg

Details for d2hcbc1

PDB Entry: 2hcb (more details), 3.51 Å

PDB Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus
PDB Compounds: (C:) Chromosomal replication initiator protein dnaA

SCOPe Domain Sequences for d2hcbc1:

Sequence, based on SEQRES records: (download)

>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkkdrkfkhlvgflekqafdkic

Sequence, based on observed residues (ATOM records): (download)

>d2hcbc1 a.4.12.2 (C:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdknkrtsearkiamylcrkvcsas
lieiarafdhttvihairsveeekkrkfkhlvgflekqafdkic

SCOPe Domain Coordinates for d2hcbc1:

Click to download the PDB-style file with coordinates for d2hcbc1.
(The format of our PDB-style files is described here.)

Timeline for d2hcbc1: