Lineage for d2hcbb2 (2hcb B:77-289)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479085Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
    contains TrpR-like DNA-binding domain after the family specific domains
  7. 2479086Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries)
  8. 2479089Domain d2hcbb2: 2hcb B:77-289 [136328]
    Other proteins in same PDB: d2hcba1, d2hcbb1, d2hcbc1, d2hcbd1
    automatically matched to d1l8qa2
    complexed with acp, mg

Details for d2hcbb2

PDB Entry: 2hcb (more details), 3.51 Å

PDB Description: Structure of AMPPCP-bound DnaA from Aquifex aeolicus
PDB Compounds: (B:) Chromosomal replication initiator protein dnaA

SCOPe Domain Sequences for d2hcbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcbb2 c.37.1.20 (B:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk

SCOPe Domain Coordinates for d2hcbb2:

Click to download the PDB-style file with coordinates for d2hcbb2.
(The format of our PDB-style files is described here.)

Timeline for d2hcbb2: