Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Chromosomal replication initiation factor DnaA [82416] (1 species) contains TrpR-like DNA-binding domain after the family specific domains |
Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries) |
Domain d2hcbb2: 2hcb B:77-289 [136328] Other proteins in same PDB: d2hcba1, d2hcbb1, d2hcbc1, d2hcbd1 automatically matched to d1l8qa2 complexed with abg, mg |
PDB Entry: 2hcb (more details), 3.51 Å
SCOP Domain Sequences for d2hcbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hcbb2 c.37.1.20 (B:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke fnlelrkevidyllentknvreiegkikliklk
Timeline for d2hcbb2: