SCOPe 2.07: Domain d2hbxb_: 2hbx B:

Lineage for d2hbxb_ (2hbx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [141825] (14 PDB entries)
   Uniprot Q83V25 3-333

8. Domain d2hbxb_: 2hbx B: [136323]
   automated match to d2hbva1
   complexed with co

Details for d2hbxb_

PDB Entry: 2hbx, 2.5 Å

PDB Description: crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd)

PDB Compounds: (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOPe Domain Sequences for d2hbxb_:

Sequence; same for both SEQRES and ATOM records:

>d2hbxb_ c.1.9.15 (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffninv

Timeline for d2hbxb_:

• d2hbxb_ first appeared in SCOP 1.73, called d2hbxb1
  
• d2hbxb_ appears in SCOPe 2.06
  
• d2hbxb_ appears in the current release, SCOPe 2.08