SCOP 1.73: Domain d2hbxb1: 2hbx B:3-333

Lineage for d2hbxb1 (2hbx B:3-333)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [141825] (2 PDB entries)

8. Domain d2hbxb1: 2hbx B:3-333 [136323]
   automatically matched to 2HBV A:3-333
   complexed with co

Details for d2hbxb1

PDB Entry: 2hbx, 2.5 Å

PDB Description: crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd)

PDB Compounds: (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOP Domain Sequences for d2hbxb1:

Sequence; same for both SEQRES and ATOM records:

>d2hbxb1 c.1.9.15 (B:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffnin

Timeline for d2hbxb1:

• d2hbxb1 is new in SCOP 1.73
  
• d2hbxb1 appears in SCOP 1.75
  
• d2hbxb1 appears in the current release, SCOPe 2.08, called d2hbxb_