![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
![]() | Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [141825] (14 PDB entries) Uniprot Q83V25 3-333 |
![]() | Domain d2hbxb_: 2hbx B: [136323] automated match to d2hbva1 complexed with co |
PDB Entry: 2hbx (more details), 2.5 Å
SCOPe Domain Sequences for d2hbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbxb_ c.1.9.15 (B:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq kigglvlssnlgesakdkiisgnaskffninv
Timeline for d2hbxb_: