Lineage for d2hbva1 (2hbv A:3-333)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683885Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 683886Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)
  7. 683887Species Pseudomonas fluorescens [TaxId:294] [141825] (2 PDB entries)
  8. 683888Domain d2hbva1: 2hbv A:3-333 [136320]
    complexed with mg, zn

Details for d2hbva1

PDB Entry: 2hbv (more details), 1.65 Å

PDB Description: crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd)
PDB Compounds: (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOP Domain Sequences for d2hbva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffnin

SCOP Domain Coordinates for d2hbva1:

Click to download the PDB-style file with coordinates for d2hbva1.
(The format of our PDB-style files is described here.)

Timeline for d2hbva1: