Lineage for d2hboa1 (2hbo A:12-153)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188023Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2188032Protein Hypothetical protein CC3309 [143177] (1 species)
  7. 2188033Species Caulobacter crescentus [TaxId:155892] [143178] (1 PDB entry)
    Uniprot Q9A395 12-153
  8. 2188034Domain d2hboa1: 2hbo A:12-153 [136319]
    complexed with edo, pe4

Details for d2hboa1

PDB Entry: 2hbo (more details), 1.85 Å

PDB Description: crystal structure of a thioesterase superfamily protein (cc_3309) from caulobacter vibrioides at 1.85 a resolution
PDB Compounds: (A:) Hypothetical protein (np_422103.1)

SCOPe Domain Sequences for d2hboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]}
aipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgnchggmlmsfadm
awgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlftvrgriwagertl
itgtgvfkalsarkprpgelay

SCOPe Domain Coordinates for d2hboa1:

Click to download the PDB-style file with coordinates for d2hboa1.
(The format of our PDB-style files is described here.)

Timeline for d2hboa1: