SCOP 1.75: Domain d2hbma1: 2hbm A:421-516

Lineage for d2hbma1 (2hbm A:421-516)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (4 families)

5. Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins)

6. Protein Exosome complex exonuclease RRP6 domain [140647] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries)
   Uniprot Q12149 421-516

8. Domain d2hbma1: 2hbm A:421-516 [136317]
   Other proteins in same PDB: d2hbma2
   automatically matched to 2HBJ A:421-516
   complexed with mn, u, zn; mutant

Details for d2hbma1

PDB Entry: 2hbm, 2.7 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain; protein in complex with mn, zn, and ump

PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOP Domain Sequences for d2hbma1:

Sequence; same for both SEQRES and ATOM records:

>d2hbma1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn

Timeline for d2hbma1:

• d2hbma1 first appeared in SCOP 1.73
  
• d2hbma1 appears in SCOPe 2.01
  
• d2hbma1 appears in the current release, SCOPe 2.08