SCOPe 2.08: Domain d2hbla2: 2hbl A:129-420

Lineage for d2hbla2 (2hbl A:129-420)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exosome complex exonuclease RRP6 [142493] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142494] (4 PDB entries)
   Uniprot Q12149 129-420

8. Domain d2hbla2: 2hbl A:129-420 [136316]
   Other proteins in same PDB: d2hbla1, d2hbla3
   automated match to d2hbja2
   protein/RNA complex; complexed with amp, mn, zn
   has additional insertions and/or extensions that are not grouped together

Details for d2hbla2

PDB Entry: 2hbl, 2.3 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain; protein in complex with mn, zn, and amp

PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOPe Domain Sequences for d2hbla2:

Sequence; same for both SEQRES and ATOM records:

>d2hbla2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeyeid
hqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrsyy
givclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlglyv
vglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradthf
llniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspie

Timeline for d2hbla2:

• d2hbla2 first appeared in SCOP 1.73
  
• d2hbla2 appears in SCOPe 2.07