Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) |
Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins) |
Protein Exosome complex exonuclease RRP6 domain [140647] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries) Uniprot Q12149 421-516 |
Domain d2hbla1: 2hbl A:421-516 [136315] Other proteins in same PDB: d2hbla2 automatically matched to 2HBJ A:421-516 complexed with amp, mn, zn; mutant |
PDB Entry: 2hbl (more details), 2.3 Å
SCOP Domain Sequences for d2hbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbla1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv igvvsltngvtehvrqnakllanlirdalrnikntn
Timeline for d2hbla1: