Lineage for d2hbla1 (2hbl A:421-516)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643210Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 643242Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins)
  6. 643243Protein Exosome complex exonuclease RRP6 domain [140647] (1 species)
  7. 643244Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries)
  8. 643247Domain d2hbla1: 2hbl A:421-516 [136315]
    Other proteins in same PDB: d2hbla2
    automatically matched to 2HBJ A:421-516
    complexed with amp, mn, zn; mutant

Details for d2hbla1

PDB Entry: 2hbl (more details), 2.3 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain; protein in complex with mn, zn, and amp
PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOP Domain Sequences for d2hbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbla1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn

SCOP Domain Coordinates for d2hbla1:

Click to download the PDB-style file with coordinates for d2hbla1.
(The format of our PDB-style files is described here.)

Timeline for d2hbla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hbla2