Lineage for d2hbka2 (2hbk A:129-420)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702392Protein Exosome complex exonuclease RRP6 [142493] (1 species)
  7. 702393Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142494] (4 PDB entries)
  8. 702395Domain d2hbka2: 2hbk A:129-420 [136314]
    Other proteins in same PDB: d2hbka1
    automatically matched to 2HBJ A:129-420
    complexed with mn; mutant

Details for d2hbka2

PDB Entry: 2hbk (more details), 2.25 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain; protein in complex with mn
PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOP Domain Sequences for d2hbka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeyeid
hqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrsyy
givclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlglyv
vglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradthf
llniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspie

SCOP Domain Coordinates for d2hbka2:

Click to download the PDB-style file with coordinates for d2hbka2.
(The format of our PDB-style files is described here.)

Timeline for d2hbka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hbka1