![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exosome complex exonuclease RRP6 [142493] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142494] (4 PDB entries) Uniprot Q12149 129-420 |
![]() | Domain d2hbka2: 2hbk A:129-420 [136314] Other proteins in same PDB: d2hbka1, d2hbka3 automated match to d2hbja2 protein/RNA complex; complexed with mn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hbk (more details), 2.25 Å
SCOPe Domain Sequences for d2hbka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeyeid hqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrsyy givclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlglyv vglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradthf llniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspie
Timeline for d2hbka2: