SCOP 1.73: Domain d2hbja2: 2hbj A:129-420

Lineage for d2hbja2 (2hbj A:129-420)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exosome complex exonuclease RRP6 [142493] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142494] (4 PDB entries)

8. Domain d2hbja2: 2hbj A:129-420 [136312]
   Other proteins in same PDB: d2hbja1
   mutant

Details for d2hbja2

PDB Entry: 2hbj, 2.1 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain

PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOP Domain Sequences for d2hbja2:

Sequence; same for both SEQRES and ATOM records:

>d2hbja2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vekpqlkfkspidnseshpfipllkekpnalkplseslrlvdddennpshyphpyeyeid
hqeyspeilqireeipskswddsvpiwvdtstelesmledlkntkeiavdlehhdyrsyy
givclmqistrerdylvdtlklrenlhilnevftnpsivkvfhgafmdiiwlqrdlglyv
vglfdtyhaskaiglprhslayllenfanfktskkyqladwrirplskpmtaaaradthf
llniydqlrnkliesnklagvlyesrnvakrrfeyskyrpltpssevyspie

Timeline for d2hbja2:

• d2hbja2 is new in SCOP 1.73
  
• d2hbja2 appears in SCOP 1.75
  
• d2hbja2 appears in the current release, SCOPe 2.08