Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (3 families) |
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) automatically mapped to Pfam PF01281 |
Protein Ribosomal protein L9 N-domain [55660] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries) |
Domain d2hbba1: 2hbb A:1-51 [136310] automatically matched to d1cqua_ complexed with zn |
PDB Entry: 2hbb (more details), 1.9 Å
SCOPe Domain Sequences for d2hbba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbba1 d.100.1.1 (A:1-51) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]} mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqk
Timeline for d2hbba1: