Lineage for d2hbba1 (2hbb A:1-51)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967248Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2967249Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2967250Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2967251Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries)
  8. 2967255Domain d2hbba1: 2hbb A:1-51 [136310]
    automatically matched to d1cqua_
    complexed with zn

Details for d2hbba1

PDB Entry: 2hbb (more details), 1.9 Å

PDB Description: crystal structure of the n-terminal domain of ribosomal protein l9 (ntl9)
PDB Compounds: (A:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2hbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbba1 d.100.1.1 (A:1-51) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqk

SCOPe Domain Coordinates for d2hbba1:

Click to download the PDB-style file with coordinates for d2hbba1.
(The format of our PDB-style files is described here.)

Timeline for d2hbba1: