Lineage for d2hb9a_ (2hb9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996805Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2996822Domain d2hb9a_: 2hb9 A: [136309]
    automated match to d1smla_
    complexed with l13, so4, zn

Details for d2hb9a_

PDB Entry: 2hb9 (more details), 1.75 Å

PDB Description: crystal structure of the zinc-beta-lactamase l1 from stenotrophomonas maltophilia (inhibitor 3)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2hb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hb9a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2hb9a_:

Click to download the PDB-style file with coordinates for d2hb9a_.
(The format of our PDB-style files is described here.)

Timeline for d2hb9a_: