Lineage for d2hb7a_ (2hb7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342688Domain d2hb7a_: 2hb7 A: [136307]
    automated match to d1ie9a_
    complexed with o1c

Details for d2hb7a_

PDB Entry: 2hb7 (more details), 1.8 Å

PDB Description: crystal structure of vdr lbd in complex with 2alpha(3-hydroxy-1- propyl) calcitriol
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d2hb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hb7a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOPe Domain Coordinates for d2hb7a_:

Click to download the PDB-style file with coordinates for d2hb7a_.
(The format of our PDB-style files is described here.)

Timeline for d2hb7a_: