Lineage for d2hb7a1 (2hb7 A:119-423)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 777031Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 777032Species Human (Homo sapiens) [TaxId:9606] [48529] (13 PDB entries)
  8. 777035Domain d2hb7a1: 2hb7 A:119-423 [136307]
    automatically matched to d1ie9a_
    complexed with o1c

Details for d2hb7a1

PDB Entry: 2hb7 (more details), 1.8 Å

PDB Description: crystal structure of vdr lbd in complex with 2alpha(3-hydroxy-1- propyl) calcitriol
PDB Compounds: (A:) Vitamin D3 receptor

SCOP Domain Sequences for d2hb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hb7a1 a.123.1.1 (A:119-423) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOP Domain Coordinates for d2hb7a1:

Click to download the PDB-style file with coordinates for d2hb7a1.
(The format of our PDB-style files is described here.)

Timeline for d2hb7a1: