Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141033] (1 PDB entry) |
Domain d2haza1: 2haz A:489-589 [136303] complexed with na |
PDB Entry: 2haz (more details), 1.7 Å
SCOP Domain Sequences for d2haza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm egivtivglkpettyavrlaalngkglgeisaasefktqpv
Timeline for d2haza1: