SCOP 1.73: Domain d2haza1: 2haz A:489-589

Lineage for d2haza1 (2haz A:489-589)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (1 PDB entry)

8. Domain d2haza1: 2haz A:489-589 [136303]
   complexed with na

Details for d2haza1

PDB Entry: 2haz, 1.7 Å

PDB Description: Crystal structure of the first fibronectin domain of human NCAM1

PDB Compounds: (A:) Neural cell adhesion molecule 1

SCOP Domain Sequences for d2haza1:

Sequence; same for both SEQRES and ATOM records:

>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv

Timeline for d2haza1:

• d2haza1 is new in SCOP 1.73
  
• d2haza1 appears in SCOP 1.75
  
• d2haza1 appears in the current release, SCOPe 2.08