Lineage for d2haza1 (2haz A:489-589)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762066Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 2762067Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
    Uniprot P13592 498-598
  8. 2762068Domain d2haza1: 2haz A:489-589 [136303]
    Other proteins in same PDB: d2haza2
    complexed with na

Details for d2haza1

PDB Entry: 2haz (more details), 1.7 Å

PDB Description: Crystal structure of the first fibronectin domain of human NCAM1
PDB Compounds: (A:) Neural cell adhesion molecule 1

SCOPe Domain Sequences for d2haza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv

SCOPe Domain Coordinates for d2haza1:

Click to download the PDB-style file with coordinates for d2haza1.
(The format of our PDB-style files is described here.)

Timeline for d2haza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2haza2