Lineage for d2haza1 (2haz A:489-589)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
Uniprot P13592 498-598
Domain d2haza1: 2haz A:489-589 [136303]
Other proteins in same PDB: d2haza2
complexed with na
Details for d2haza1
PDB Entry: 2haz (more details), 1.7 Å
PDB Description: Crystal structure of the first fibronectin domain of human NCAM1
PDB Compounds: (A:) Neural cell adhesion molecule 1SCOPe Domain Sequences for d2haza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv
SCOPe Domain Coordinates for d2haza1:
Click to download the PDB-style file with coordinates for d2haza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2haza1:
- d2haza1 first appeared in SCOP 1.73
- d2haza1 appears in SCOPe 2.07
View in 3D
