SCOPe 2.05: Domain d2haxb_: 2hax B:

Lineage for d2haxb_ (2hax B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)

8. Domain d2haxb_: 2hax B: [136302]
   automated match to d1c9oa_
   protein/DNA complex; complexed with ca, mpd

Details for d2haxb_

PDB Entry: 2hax, 1.29 Å

PDB Description: crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine

PDB Compounds: (B:) Cold shock protein cspB

SCOPe Domain Sequences for d2haxb_:

Sequence; same for both SEQRES and ATOM records:

>d2haxb_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

Timeline for d2haxb_:

• d2haxb_ first appeared in SCOP 1.73, called d2haxb1
  
• d2haxb_ appears in SCOPe 2.04
  
• d2haxb_ appears in SCOPe 2.06
  
• d2haxb_ appears in the current release, SCOPe 2.08