SCOP 1.75: Domain d2haxa1: 2hax A:1-66

Lineage for d2haxa1 (2hax A:1-66)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)

8. Domain d2haxa1: 2hax A:1-66 [136301]
   automatically matched to d1c9oa_
   complexed with ca, mpd

Details for d2haxa1

PDB Entry: 2hax, 1.29 Å

PDB Description: crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine

PDB Compounds: (A:) Cold shock protein cspB

SCOP Domain Sequences for d2haxa1:

Sequence; same for both SEQRES and ATOM records:

>d2haxa1 b.40.4.5 (A:1-66) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

Timeline for d2haxa1:

• d2haxa1 first appeared in SCOP 1.73
  
• d2haxa1 is called d2haxa_ in SCOPe 2.01
  
• d2haxa1 appears in the current release, SCOPe 2.08, called d2haxa_