Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.107: DHH phosphoesterases [64181] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456 Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest |
Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains |
Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins) |
Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) |
Species Bacillus subtilis [TaxId:1423] [69610] (5 PDB entries) Uniprot P37487 |
Domain d2hawb_: 2haw B: [136300] automated match to d1k23c_ complexed with 1pe, 2pn, cl, f, gol, mg, pg4, so4 |
PDB Entry: 2haw (more details), 1.75 Å
SCOPe Domain Sequences for d2hawb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hawb_ c.107.1.1 (B:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]} mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv pvltdama
Timeline for d2hawb_: