SCOP 1.73: Domain d2hawb1: 2haw B:2-308

Lineage for d2hawb1 (2haw B:2-308)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (2 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)

6. Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69610] (4 PDB entries)

8. Domain d2hawb1: 2haw B:2-308 [136300]
   automatically matched to d1k23c_
   complexed with 1pe, 2pn, cl, f, gol, mg, pg4, so4

Details for d2hawb1

PDB Entry: 2haw, 1.75 Å

PDB Description: Crystal structure of family II Inorganic pyrophosphatase in complex with PNP

PDB Compounds: (B:) Manganese-dependent inorganic pyrophosphatase

SCOP Domain Sequences for d2hawb1:

Sequence; same for both SEQRES and ATOM records:

>d2hawb1 c.107.1.1 (B:2-308) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
ekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprlv
etaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgctat
ilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeeyg
lnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleaviskv
vaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvvp
vltdama

Timeline for d2hawb1:

• d2hawb1 is new in SCOP 1.73
  
• d2hawb1 appears in SCOP 1.75
  
• d2hawb1 appears in the current release, SCOPe 2.08, called d2hawb_