Lineage for d2hawa1 (2haw A:2-308)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847900Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 847901Superfamily c.107.1: DHH phosphoesterases [64182] (2 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 847902Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)
  6. 847903Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)
  7. 847904Species Bacillus subtilis [TaxId:1423] [69610] (4 PDB entries)
    Uniprot P37487
  8. 847907Domain d2hawa1: 2haw A:2-308 [136299]
    automatically matched to d1k23c_
    complexed with 1pe, 2pn, cl, f, gol, mg, pg4, so4

Details for d2hawa1

PDB Entry: 2haw (more details), 1.75 Å

PDB Description: Crystal structure of family II Inorganic pyrophosphatase in complex with PNP
PDB Compounds: (A:) Manganese-dependent inorganic pyrophosphatase

SCOP Domain Sequences for d2hawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hawa1 c.107.1.1 (A:2-308) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
ekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprlv
etaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgctat
ilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeeyg
lnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleaviskv
vaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvvp
vltdama

SCOP Domain Coordinates for d2hawa1:

Click to download the PDB-style file with coordinates for d2hawa1.
(The format of our PDB-style files is described here.)

Timeline for d2hawa1: