![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
![]() | Protein Transferrin [53897] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries) |
![]() | Domain d2havb1: 2hav B:340-664 [136298] automatically matched to d1jnfa1 complexed with cit, gol |
PDB Entry: 2hav (more details), 2.7 Å
SCOPe Domain Sequences for d2havb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2havb1 c.94.1.2 (B:340-664) Transferrin {Human (Homo sapiens) [TaxId: 9606]} kpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyia gkcglvpvlaenynksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrtag wnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytg afrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchl arapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvcla klhdrntyekylgeeyvkavgnlrk
Timeline for d2havb1: