Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.2: Transferrin [53888] (3 proteins) further duplication: composed of two two-domain lobes |
Protein Transferrin [53897] (3 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (4 PDB entries) |
Domain d2hava1: 2hav A:340-664 [136297] automatically matched to d1jnfa1 complexed with cit, gol |
PDB Entry: 2hav (more details), 2.7 Å
SCOP Domain Sequences for d2hava1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} kpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyia gkcglvpvlaenynksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrtag wnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytg afrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchl arapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvcla klhdrntyekylgeeyvkavgnlrk
Timeline for d2hava1: