Lineage for d2haub1 (2hau B:340-664)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522358Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2522470Protein Transferrin [53897] (3 species)
  7. 2522471Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)
  8. 2522494Domain d2haub1: 2hau B:340-664 [136296]
    automatically matched to d1jnfa1
    complexed with cit, gol

Details for d2haub1

PDB Entry: 2hau (more details), 2.7 Å

PDB Description: apo-human serum transferrin (non-glycosylated)
PDB Compounds: (B:) serotransferrin

SCOPe Domain Sequences for d2haub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haub1 c.94.1.2 (B:340-664) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
kpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyia
gkcglvpvlaenydksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrtag
wnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytg
afrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchl
arapnhavvtrkdkeacvhkilrqqqhlfgsdvtdcsgnfclfrsetkdllfrddtvcla
klhdrntyekylgeeyvkavgnlrk

SCOPe Domain Coordinates for d2haub1:

Click to download the PDB-style file with coordinates for d2haub1.
(The format of our PDB-style files is described here.)

Timeline for d2haub1: