SCOPe 2.01: Domain d2haub1: 2hau B:340-664

Lineage for d2haub1 (2hau B:340-664)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (4 PDB entries)

8. Domain d2haub1: 2hau B:340-664 [136296]
   automatically matched to d1jnfa1
   complexed with cit, gol

Details for d2haub1

PDB Entry: 2hau, 2.7 Å

PDB Description: apo-human serum transferrin (non-glycosylated)

PDB Compounds: (B:) serotransferrin

SCOPe Domain Sequences for d2haub1:

Sequence; same for both SEQRES and ATOM records:

>d2haub1 c.94.1.2 (B:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
kpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyia
gkcglvpvlaenydksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrtag
wnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytg
afrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchl
arapnhavvtrkdkeacvhkilrqqqhlfgsdvtdcsgnfclfrsetkdllfrddtvcla
klhdrntyekylgeeyvkavgnlrk

Timeline for d2haub1:

• d2haub1 first appeared in SCOP 1.73
  
• d2haub1 appears in SCOP 1.75
  
• d2haub1 appears in SCOPe 2.02
  
• d2haub1 appears in the current release, SCOPe 2.08