SCOPe 2.07: Domain d2haua1: 2hau A:340-664

Lineage for d2haua1 (2hau A:340-664)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)

8. Domain d2haua1: 2hau A:340-664 [136295]
   automatically matched to d1jnfa1
   complexed with cit, gol

Details for d2haua1

PDB Entry: 2hau, 2.7 Å

PDB Description: apo-human serum transferrin (non-glycosylated)

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d2haua1:

Sequence; same for both SEQRES and ATOM records:

>d2haua1 c.94.1.2 (A:340-664) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
kpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyia
gkcglvpvlaenydksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrtag
wnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytg
afrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchl
arapnhavvtrkdkeacvhkilrqqqhlfgsdvtdcsgnfclfrsetkdllfrddtvcla
klhdrntyekylgeeyvkavgnlrk

Timeline for d2haua1:

• d2haua1 first appeared in SCOP 1.73
  
• d2haua1 appears in SCOPe 2.06
  
• d2haua1 appears in the current release, SCOPe 2.08