![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
![]() | Protein automated matches [190314] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187128] (1 PDB entry) |
![]() | Domain d2hanb_: 2han B: [136292] automated match to d2nllb_ protein/DNA complex; complexed with zn |
PDB Entry: 2han (more details), 1.95 Å
SCOPe Domain Sequences for d2hanb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hanb_ g.39.1.2 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rvqeelclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcq ecrlkkclavgmrpecvvpenqcamkr
Timeline for d2hanb_: