Lineage for d2haja_ (2haj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015796Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 2015797Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. 2015798Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (1 protein)
  6. 2015799Protein DNA primase DnaG, C-terminal domain [117025] (1 species)
  7. 2015800Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
    Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)
  8. 2015803Domain d2haja_: 2haj A: [136288]
    automated match to d1t3wb_

Details for d2haja_

PDB Entry: 2haj (more details)

PDB Description: Solution structure of the helicase-binding domain of Escherichia coli primase
PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d2haja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haja_ a.236.1.1 (A:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelakk

SCOPe Domain Coordinates for d2haja_:

Click to download the PDB-style file with coordinates for d2haja_.
(The format of our PDB-style files is described here.)

Timeline for d2haja_: