SCOPe 2.08: Domain d2haja_: 2haj A:

Lineage for d2haja_ (2haj A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
   multihelical; segment-swapped dimer

4. Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families)
   automatically mapped to Pfam PF08278

5. Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (2 proteins)

6. Protein DNA primase DnaG, C-terminal domain [117025] (1 species)

7. Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
   Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)

8. Domain d2haja_: 2haj A: [136288]
   automated match to d1t3wb_

Details for d2haja_

PDB Entry: 2haj

PDB Description: solution structure of the helicase-binding domain of escherichia coli primase

PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d2haja_:

Sequence; same for both SEQRES and ATOM records:

>d2haja_ a.236.1.1 (A:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelakk

Timeline for d2haja_:

• d2haja_ first appeared in SCOP 1.73, called d2haja1
  
• d2haja_ appears in SCOPe 2.07