SCOPe 2.07: Domain d2haga1: 2hag A:5-311

Lineage for d2haga1 (2hag A:5-311)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
   Pfam PF04261

6. Protein Melanin biosynthesis protein TyrA [143270] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries)
   Uniprot Q8EIU4 5-311

8. Domain d2haga1: 2hag A:5-311 [136287]

Details for d2haga1

PDB Entry: 2hag, 2.75 Å

PDB Description: crystal structure of a putative dyp-type peroxidase protein (so_0740) from shewanella oneidensis at 2.75 a resolution

PDB Compounds: (A:) Melanin biosynthesis protein TyrA, putative

SCOPe Domain Sequences for d2haga1:

Sequence; same for both SEQRES and ATOM records:

>d2haga1 d.58.4.14 (A:5-311) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]}
nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
flmqfdn

Timeline for d2haga1:

• d2haga1 first appeared in SCOP 1.73
  
• d2haga1 appears in SCOPe 2.06
  
• d2haga1 appears in the current release, SCOPe 2.08