Lineage for d2haga1 (2hag A:5-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949970Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
    Pfam PF04261
  6. 2949983Protein Melanin biosynthesis protein TyrA [143270] (1 species)
  7. 2949984Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries)
    Uniprot Q8EIU4 5-311
  8. 2949986Domain d2haga1: 2hag A:5-311 [136287]

Details for d2haga1

PDB Entry: 2hag (more details), 2.75 Å

PDB Description: crystal structure of a putative dyp-type peroxidase protein (so_0740) from shewanella oneidensis at 2.75 a resolution
PDB Compounds: (A:) Melanin biosynthesis protein TyrA, putative

SCOPe Domain Sequences for d2haga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haga1 d.58.4.14 (A:5-311) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]}
nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
flmqfdn

SCOPe Domain Coordinates for d2haga1:

Click to download the PDB-style file with coordinates for d2haga1.
(The format of our PDB-style files is described here.)

Timeline for d2haga1: