SCOP 1.73: Domain d2hafa1: 2haf A:15-192

Lineage for d2hafa1 (2haf A:15-192)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.310: VC0467-like [143455] (1 superfamily)
   complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel

4. Superfamily d.310.1: VC0467-like [143456] (1 family)

5. Family d.310.1.1: VC0467-like [143457] (5 proteins)
   Pfam PF02622; DUF179

6. Protein Hypothetical protein VC0467 [143462] (1 species)

7. Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)

8. Domain d2hafa1: 2haf A:15-192 [136286]

Details for d2hafa1

PDB Entry: 2haf, 2.88 Å

PDB Description: crystal structure of a putative translation repressor from vibrio cholerae

PDB Compounds: (A:) Putative translation repressor

SCOP Domain Sequences for d2hafa1:

Sequence; same for both SEQRES and ATOM records:

>d2hafa1 d.310.1.1 (A:15-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
smnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepa
ypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgtea
epegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgisp

Timeline for d2hafa1:

• d2hafa1 is new in SCOP 1.73
  
• d2hafa1 appears in SCOP 1.75
  
• d2hafa1 appears in the current release, SCOPe 2.08