SCOPe 2.08: Domain d2hafa1: 2haf A:16-192

Lineage for d2hafa1 (2haf A:16-192)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.310: VC0467-like [143455] (1 superfamily)
   complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel

4. Superfamily d.310.1: VC0467-like [143456] (2 families)
   automatically mapped to Pfam PF02622

5. Family d.310.1.1: VC0467-like [143457] (5 proteins)
   Pfam PF02622; DUF179

6. Protein Hypothetical protein VC0467 [143462] (1 species)

7. Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)
   Uniprot Q9KUP8 1-177! Uniprot Q9KUP8 1-179

8. Domain d2hafa1: 2haf A:16-192 [136286]
   Other proteins in same PDB: d2hafa2

Details for d2hafa1

PDB Entry: 2haf, 2.88 Å

PDB Description: crystal structure of a putative translation repressor from vibrio cholerae

PDB Compounds: (A:) Putative translation repressor

SCOPe Domain Sequences for d2hafa1:

Sequence; same for both SEQRES and ATOM records:

>d2hafa1 d.310.1.1 (A:16-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay
pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae
pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgisp

Timeline for d2hafa1:

• d2hafa1 first appeared in SCOP 1.73
  
• d2hafa1 appears in SCOPe 2.07