Lineage for d2hafa1 (2haf A:16-192)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010604Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 3010605Superfamily d.310.1: VC0467-like [143456] (2 families) (S)
    automatically mapped to Pfam PF02622
  5. 3010606Family d.310.1.1: VC0467-like [143457] (5 proteins)
    Pfam PF02622; DUF179
  6. 3010620Protein Hypothetical protein VC0467 [143462] (1 species)
  7. 3010621Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)
    Uniprot Q9KUP8 1-177! Uniprot Q9KUP8 1-179
  8. 3010622Domain d2hafa1: 2haf A:16-192 [136286]
    Other proteins in same PDB: d2hafa2

Details for d2hafa1

PDB Entry: 2haf (more details), 2.88 Å

PDB Description: crystal structure of a putative translation repressor from vibrio cholerae
PDB Compounds: (A:) Putative translation repressor

SCOPe Domain Sequences for d2hafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hafa1 d.310.1.1 (A:16-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay
pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae
pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgisp

SCOPe Domain Coordinates for d2hafa1:

Click to download the PDB-style file with coordinates for d2hafa1.
(The format of our PDB-style files is described here.)

Timeline for d2hafa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hafa2