Lineage for d2haed2 (2hae D:2-154)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498456Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2498457Protein automated matches [226864] (38 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [255205] (1 PDB entry)
  8. 2498690Domain d2haed2: 2hae D:2-154 [136285]
    Other proteins in same PDB: d2haea1, d2haeb1, d2haec1, d2haed1
    automated match to d1vl6a2
    complexed with nad, zn

Details for d2haed2

PDB Entry: 2hae (more details), 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)
PDB Compounds: (D:) Malate oxidoreductase

SCOPe Domain Sequences for d2haed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haed2 c.58.1.0 (D:2-154) automated matches {Thermotoga maritima [TaxId: 2336]}
dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
sfgginledigapkcfrilqrlseemnipvfhd

SCOPe Domain Coordinates for d2haed2:

Click to download the PDB-style file with coordinates for d2haed2.
(The format of our PDB-style files is described here.)

Timeline for d2haed2: