Lineage for d2haec1 (2hae C:155-376)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106264Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2106548Protein automated matches [227005] (3 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [255206] (1 PDB entry)
  8. 2106574Domain d2haec1: 2hae C:155-376 [136282]
    Other proteins in same PDB: d2haea2, d2haeb2, d2haec2, d2haed2
    automated match to d1vl6a1
    complexed with nad, zn

Details for d2haec1

PDB Entry: 2hae (more details), 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)
PDB Compounds: (C:) Malate oxidoreductase

SCOPe Domain Sequences for d2haec1:

Sequence, based on SEQRES records: (download)

>d2haec1 c.2.1.7 (C:155-376) automated matches {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

Sequence, based on observed residues (ATOM records): (download)

>d2haec1 c.2.1.7 (C:155-376) automated matches {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyeiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkp
vifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknm
llsaveaiarscepeperiipeafdmkvhlnvytavkgsa

SCOPe Domain Coordinates for d2haec1:

Click to download the PDB-style file with coordinates for d2haec1.
(The format of our PDB-style files is described here.)

Timeline for d2haec1: