SCOP 1.73: Domain d2haeb2: 2hae B:2-154

Lineage for d2haeb2 (2hae B:2-154)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Malate oxidoreductase (malic enzyme) [110452] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110453] (2 PDB entries)

8. Domain d2haeb2: 2hae B:2-154 [136281]
   Other proteins in same PDB: d2haea1, d2haeb1, d2haec1, d2haed1
   automatically matched to d1vl6a2
   complexed with nad, zn

Details for d2haeb2

PDB Entry: 2hae, 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)

PDB Compounds: (B:) Malate oxidoreductase

SCOP Domain Sequences for d2haeb2:

Sequence; same for both SEQRES and ATOM records:

>d2haeb2 c.58.1.3 (B:2-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
sfgginledigapkcfrilqrlseemnipvfhd

Timeline for d2haeb2:

• d2haeb2 is new in SCOP 1.73
  
• d2haeb2 appears in SCOP 1.75
  
• d2haeb2 appears in the current release, SCOPe 2.08