SCOP 1.73: Domain d2haeb1: 2hae B:155-376

Lineage for d2haeb1 (2hae B:155-376)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Malate oxidoreductase (malic enzyme) [110434] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110435] (2 PDB entries)

8. Domain d2haeb1: 2hae B:155-376 [136280]
   Other proteins in same PDB: d2haea2, d2haeb2, d2haec2, d2haed2
   automatically matched to d1vl6a1
   complexed with nad, zn

Details for d2haeb1

PDB Entry: 2hae, 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)

PDB Compounds: (B:) Malate oxidoreductase

SCOP Domain Sequences for d2haeb1:

Sequence, based on SEQRES records:

>d2haeb1 c.2.1.7 (B:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

Sequence, based on observed residues (ATOM records):

>d2haeb1 c.2.1.7 (B:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyeiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkp
vifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknm
llsaveaiarscepeperiipeafdmkvhlnvytavkgsa

Timeline for d2haeb1:

• d2haeb1 is new in SCOP 1.73
  
• d2haeb1 appears in SCOP 1.75
  
• d2haeb1 appears in the current release, SCOPe 2.08